General Information

  • ID:  hor000308
  • Uniprot ID:  A7LBN3
  • Protein name:  Allatostatin A
  • Gene name:  NA
  • Organism:  Calanus finmarchicus (Calanus tonsus)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Calanus (genus), Calanidae (family), Calanoida (order), Gymnoplea (superorder), Neocopepoda (infraclass), Copepoda (subclass), Hexanauplia (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APYGFGI
  • Length:  7(69-75)
  • Propeptide:  MLLWILLCQLTLTYGARPYNGQQGTMLANLAFNDNNSNGLDYEIGEDGPDTDIDVSKREPYGFGIGKRAPYGFGIGKRALYGFGIGKRAPYGFGIGKRAPYGFGIGKREPYNFGIGKRSQMWGKRQPYNFGVGKRGMLAL
  • Signal peptide:  MLLWILLCQLTLTYG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A7LBN3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000308_AF2.pdbhor000308_ESM.pdb

Physical Information

Mass: 83103 Formula: C36H49N7O9
Absent amino acids: CDEHKLMNQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 77.14 Boman Index: 1145
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 70
Instability Index: 1182.86 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  17950732
  • Title:  Identification of A-type Allatostatins Possessing -YXFGI/Vamide Carboxy-Termini From the Nervous System of the Copepod Crustacean Calanus Finmarchicus